Details of Host Protein

Host Protein General Information (ID: PT1225)
Protein Name		Uncharacterized protein KIAA1143 (ATP8B1)			Gene Name		KIAA1143
Host Species		Homo sapiens			Uniprot Entry Name		K1143_HUMAN
External Link
		NCBI Gene ID			57456
		Uniprot ID			Q96AT1
		Ensembl ID			ENSG00000081923
		HGNC ID			HGNC:29198
3D Structure		AlphaFold ID: Q96AT1    2D PNG Download     mmCIF File Download      PDB File Download

Function of This Protein During Virus Infection
Virus Name		HCoV-229E			Protein Function		Anti-viral		[1]
Infected Tissue		Colon			Infection Time		48h; 72 h
Infected Cell		Caco-2 cells (Human colorectal adenocarcinoma cells)			Cellosaurus ID		CVCL_0025
Method Description		To detect the role of host protein KIAA1143 in viral infection, KIAA1143 protein knockout Caco-2 cells were infected with HCoV-229E for 48 - 72 h , and the effects on infection was detected through qRT-PCR.
Results		It is reported that knockdown of KIAA1143 leads to the Increase SARS-CoV-2 RNA levels compared with control group.
Virus Name		SARS-COV-2			Protein Function		Anti-viral		[2]
Infected Tissue		Lung			Infection Time		7-9 Days
Infected Cell		Calu-3 Cells (Human epithelial cell line)			Cellosaurus ID		CVCL_0609
Method Description		To detect the role of host protein KIAA1143 in viral infection, KIAA1143 protein Knockdown Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results		It is reported that knockout of KIAA1143 increases SARS-CoV-2 RNA levels compared with control group.

Full List of Virus RNA Interacting with This Protien
RNA Region: 3'-UTR (hCoV-19/Wuhan-Hu-1/2019 )
RNA Region Details			RNA Info Click to show the detail information of this RNA binding region						[3]
Strains Name			hCoV-19/Wuhan-Hu-1/2019
Strains Family			Beta (B.1.351)
RNA Binding Region			3'-UTR
Virus Name			Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells			HEK293 Cells (Human embryonic kidney cell)  (CVCL_0045 )
Cell Originated Tissue			Liver
Infection Time			48 h
Interaction Score			Prot score = 29
Method Description			RNA-protein interaction detection (RaPID) assay; liquid chromatography with tandem mass spectrometry (LC-MS/MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641 Sample Type: Blood Samples Details: Healthy Control: 24; COVID-19: 62 Platform: GPL24676 Illumina NovaSeq 6000   PNG Download   GEO Accession: GSE162835 Sample Type: Nasopharyngeal Swabs Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3 Platform: GPL24676 Illumina NovaSeq 6000   PNG Download   GEO Accession: GSE175779 Sample Type: Human Bronchial Epithelial Cells Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h) Platform: GPL18573 Illumina NextSeq 500   PNG Download

Protein Phosphorylation after Virus Infection
S116 [4]   PNG Download
S50 [5]   PNG Download
S50 [4]   PNG Download

Protein Sequence Information
MSKRNQVSYVRPAEPAFLARFKERVGYREGPTVETKRIQPQPPDEDGDHSDKEDEQPQVVVLKKGDLSVEEVMKIKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKKPNEDEVNQDSVKKNSQKQIKNSSLLSFDNEDENE     Click to Show/Hide

References
1	Bidirectional genome-wide CRISPR screens reveal host factors regulating SARS-CoV-2, MERS-CoV and seasonal coronaviruses. bioRxiv. 2021 May 21;2021.05.19.444823.
2	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
3	RNA-Protein Interaction Analysis of SARS-CoV-2 5 and 3 Untranslated Regions Reveals a Role of Lysosome-Associated Membrane Protein-2a during Viral Infection. mSystems. 2021 Aug 31;6(4):e0064321.
4	Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.
5	The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.