Details of Host Protein

 Host Protein General Information (ID: PT1233)
  Protein Name
UDP-glucose pyrophosphorylase (UDPGP)
  Gene Name
UGP2
  Host Species
Homo sapiens
  Uniprot Entry Name
UGPA_HUMAN
  Protein Families
UDPGP type 1 family
  EC Number
2.7.7.9
  Subcellular Location
Cytoplasm
  External Link
NCBI Gene ID
7360
Uniprot ID
Q16851
Ensembl ID
ENSG00000169764
HGNC ID
HGNC:12527
  Function in Host
UTP--glucose-1-phosphate uridylyltransferase catalyzing theconversion of glucose-1-phosphate into UDP-glucose, a crucial precursorfor the production of glycogen. [1-3]
    Click to Show/Hide
  Related KEGG Pathway
Amino sugar and nucleotide sugar metabolism hsa00520            Pathway Map 
Metabolic pathways hsa01100            Pathway Map 
Pentose and glucuronate interconversions hsa00040            Pathway Map 
Galactose metabolism hsa00052            Pathway Map 
Starch and sucrose metabolism hsa00500            Pathway Map 
Biosynthesis of cofactors hsa01240            Pathway Map 
Biosynthesis of nucleotide sugars hsa01250            Pathway Map 
Pentose and glucuronate interconversions hsa00040            Pathway Map 
Galactose metabolism hsa00052            Pathway Map 
Starch and sucrose metabolism hsa00500            Pathway Map 
Amino sugar and nucleotide sugar metabolism hsa00520            Pathway Map 
Metabolic pathways hsa01100            Pathway Map 
Biosynthesis of cofactors hsa01240            Pathway Map 
Biosynthesis of nucleotide sugars hsa01250            Pathway Map 
  3D Structure
PDB ID: 3R2W 
FASTA   Download
  2D PNG Download  
PDB File Download

 Full List of Virus RNA Interacting with This Protien
            RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [4]
              Strains Name
hCoV-19/Not Specified Virus Strain
              RNA Binding Region
ORF10
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Calu-3 cells (Human Lung Cancer Cell)  (CVCL_0609 )
              Cell Originated Tissue Liver
              Interaction Score P-value < 0.05
              Method Description RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Sequence Information
MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
    Click to Show/Hide

References
1 Loss of UGP2 in brain leads to a severe epileptic encephalopathy, emphasizing that bi-allelic isoform-specific start-loss mutations of essential genes can cause genetic diseases. Acta Neuropathol. 2020 Mar;139(3):415-442.
2 Sequence differences between human muscle and liver cDNAs for UDPglucose pyrophosphorylase and kinetic properties of the recombinant enzymes expressed in Escherichia coli. Eur J Biochem. 1996 Jan 15;235(1-2):173-9.
3 Cloning of a human liver UDP-glucose pyrophosphorylase cDNA by complementation of the bacterial galU mutation. FEBS Lett. 1993 Aug 23;329(1-2):153-8.
4 Mapping the host protein interactome of non-coding regions in SARS-CoV-2 genome. bioRxiv. 2021 Jun; DOI:10.1101/2021.06.19.449092.