Details of Host Protein
Host Protein General Information (ID: PT1258) | |||||||||
---|---|---|---|---|---|---|---|---|---|
Protein Name |
Y-box-binding protein 2 (SHFL )
|
Gene Name |
YBX2
|
||||||
Host Species |
Homo sapiens
|
Uniprot Entry Name |
YBOX2_HUMAN
|
||||||
Subcellular Location |
Cytoplasm Nucleus
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Function in Host |
Major constituent of messenger ribonucleoprotein particles (mRNPs). Involved in the regulation of the stability and/or translationof germ cell mRNAs. Binds to Y-box consensus promoter element. Binds tofull-length mRNA with high affinity in a sequence-independent manner. Binds to short RNA sequences containing the consensus site 5'-UCCAUCA-3' with low affinity and limited sequence specificity. Its binding withmaternal mRNAs is necessary for its cytoplasmic retention. May markspecific mRNAs (those transcribed from Y-box promoters) in the nucleusfor cytoplasmic storage, thereby linking transcription and mRNAstorage/translational delay.
Click to Show/Hide
|
||||||||
3D Structure |
|
Host Protein - Virus RNA Network | |||||||||
---|---|---|---|---|---|---|---|---|---|
Full List of Virus RNA Interacting with This Protien | |||||||||
---|---|---|---|---|---|---|---|---|---|
RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[1] | |||||||
Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
RNA Binding Region |
ORF10
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7 cells (human liver cell line) (CVCL_0336 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Interaction Score | P-value < 0.05 | ||||||||
Method Description | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | ||||||||
RNA Region: ORF1ab (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[2] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF1ab
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: ORF3a (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[2] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF3a
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: ORF6 (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[2] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF6
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: ORF8 (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[2] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF8
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: M region (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[2] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
M region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: N region (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[2] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
N region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: S region (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[2] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package |
Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Protein Sequence Information | ||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE
Click to Show/Hide
|