Details of Host Protein

 Host Protein General Information (ID: PT1274)
  Protein Name
Zinc finger CCHC domain-containing protein 3 (PINX1)
  Gene Name
ZCCHC3
  Host Species
Homo sapiens
  Uniprot Entry Name
ZCHC3_HUMAN
  Subcellular Location
Cytoplasm
  External Link
NCBI Gene ID
85364
Uniprot ID
Q9NUD5
Ensembl ID
ENSG00000254093
HGNC ID
HGNC:16230
  Function in Host
Nucleic acid-binding protein involved in innate immuneresponse to DNA and RNA viruses. Binds DNA and RNA in the cytoplasm and acts by promoting recognition ofviral nucleic acids by virus sensors, such as DDX58/RIG-I, IFIH1/MDA5and CGAS. Acts as a co-sensor forrecognition of double-stranded DNA (dsDNA) by cGAS in the cytoplasm, thereby playing a role in innate immune response to cytosolic dsDNA andDNA virus. Binds dsDNA and probably acts by promotingsensing of dsDNA by CGAS, leading to enhance CGAS oligomerization andactivation. Promotes sensing of viral RNA by RIG-I-like receptors proteins DDX58/RIG-I and IFIH1/MDA5 via two mechanisms:binds double-stranded RNA (dsRNA), enhancing the binding of DDX58/RIG-Iand IFIH1/MDA5 to dsRNA and promotes 'Lys-63'-linked ubiquitination andsubsequent activation of DDX58/RIG-I and IFIH1/MDA5. [1-2]
    Click to Show/Hide
  3D Structure
AlphaFold ID: Q9NUD5 
  2D PNG Download  
  mmCIF File Download   
  PDB File Download   

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [3]
              Strains Name
hCoV-19/USA/WA1/2020
              Strains Family
Alpha (B.1.1.7)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7.5 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_7927 )
              Cell Originated Tissue Liver
              Infection Time 48 h
              Interaction Score FDR ≤ 0.05
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Sequence Information
MATGGGAEEERKRGRPQLLPPARPAARGEEADGGREKMGWAQVVKNLAEKKGEFREPRPPRREEESGGGGGSAGLGGPAGLAAPDLGDFPPAGRGDPKGRRRDPAGEAVDPRKKKGAAEAGRRKKAEAAAAAMATPARPGEAEDAAERPLQDEPAAAAGPGKGRFLVRICFQGDEGACPTRDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAEKLALFLRVYEEKREQEDCWENFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGSCTQDRCFRCGEEGHLSPYCRKGIVCNLCGKRGHAFAQCPKAVHNSVAAQLTGVAGH
    Click to Show/Hide

References
1 The Zinc-Finger Protein ZCCHC3 Binds RNA and Facilitates Viral RNA Sensing and Activation of the RIG-I-like Receptors. Immunity. 2018 Sep 18;49(3):438-448.e5.
2 ZCCHC3 is a co-sensor of cGAS for dsDNA recognition in innate immune response. Nat Commun. 2018 Aug 22;9(1):3349.
3 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.