Details of Host Protein

KEGG: hsa04666 Pathway Download ×

KEGG: hsa05170 Pathway Download ×

KEGG: hsa05133 Pathway Download ×

KEGG: hsa04810 Pathway Download ×

KEGG: hsa04360 Pathway Download ×

Host Protein General Information (ID: PT0281)
Protein Name	18 kDa phosphoprotein (p18)	Gene Name	CFL1
Host Species	Homo sapiens	Uniprot Entry Name	COF1_HUMAN
Protein Families	Actin-binding proteins ADF family
Subcellular Location	Plasma membrane; nucleus; cytoskeleton
External Link
	NCBI Gene ID	1072
	Uniprot ID	P23528
	Ensembl ID	ENSG00000172757
	HGNC ID	HGNC:1874
Function in Host	Binds to F-actin and exhibits pH-sensitive F-actindepolymerizing activity. In conjunction with thesubcortical maternal complex (SCMC), plays an essential role forzygotes to progress beyond the first embryonic cell divisions viaregulation of actin dynamics. Required for thecentralization of the mitotic spindle and symmetric division of zygotes. Plays a role in the regulation of cell morphology andcytoskeletal organization in epithelial cells. Required for the up-regulation of atypical chemokine receptor ACKR2from endosomal compartment to cell membrane, increasing its efficiencyin chemokine uptake and degradation. Required forneural tube morphogenesis and neural crest cell migration. [1-4] Click to Show/Hide
Related KEGG Pathway
	Fc gamma R-mediated phagocytosis	hsa04666		Pathway Map
	Human immunodeficiency virus 1 infection	hsa05170		Pathway Map
	Pertussis	hsa05133		Pathway Map
	Regulation of actin cytoskeleton	hsa04810		Pathway Map
	Axon guidance	hsa04360		Pathway Map
3D Structure	PDB ID: 1Q8G FASTA Download 2D PNG Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Anti-viral	[5]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein CFL1 in viral infection, CFL1 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of CFL1 increases SARS-CoV-2 RNA levels compared with control group.

Host Protein - Virus RNA Network

Network Download

Full List of Virus RNA Interacting with This Protien
*RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[6]
Strains Name	hCoV-19/USA/WA1/2020
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_7927 )
Cell Originated Tissue	Liver
Infection Time	48 h
Interaction Score	FDR ≤ 0.05
Method Description	comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)
*RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[7]
Strains Name	hCoV-19/Not Specified Virus Strain
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Huh7 cells (liver carcinoma cell) Huh7 cells (liver carcinoma cell) (CVCL_0336 )
Cell Originated Tissue	Liver
Infection Time	24h
Interaction Score	log2FC = 4.24439E+14
Method Description	RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Phosphorylation after Virus Infection
S156 [8] PNG Download
S23 [8] PNG Download
S24 [8] PNG Download
S3 [8] PNG Download
S41 [8] PNG Download
T25 [8] PNG Download

Protein Sequence Information
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL Click to Show/Hide

References
1	B-arrestin-dependent activation of the cofilin pathway is required for the scavenging activity of the atypical chemokine receptor D6. Sci Signal. 2013 Apr 30;6(273):ra30.1-11, S1-3.
2	Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration. BMC Biol. 2011 Aug 11;9:54.
3	Chronophin, a novel HAD-type serine protein phosphatase, regulates cofilin-dependent actin dynamics. Nat Cell Biol. 2005 Jan;7(1):21-9.
4	Determining the differences in actin binding by human ADF and cofilin. J Mol Biol. 2002 Jan 25;315(4):911-25.
5	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
6	Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.
7	The SARS-CoV-2 RNA-protein interactome in infected human cells. Nat Microbiol. 2021 Mar;6(3):339-353.
8	Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.