Host Protein General Information (ID: PT0334)
  Protein Name
GTP-binding protein 1 (DRG-1)
  Gene Name
DRG1
  Host Species
Homo sapiens
  Uniprot Entry Name
DRG1_HUMAN
  Protein Families
TRAFAC class OBG-HflX-like GTPase superfamily
  EC Number
3.6.5.-
  Subcellular Location
Nucleus Cytoplasm
  External Link
NCBI Gene ID
4733
Uniprot ID
Q9Y295
Ensembl ID
ENSG00000185721
HGNC ID
HGNC:3029
  Function in Host
Catalyzes the conversion of GTP to GDP through hydrolysis ofthe gamma-phosphate bond in GTP. Appears to have an intrinsic GTPase activity that is stimulated byZC3H15/DFRP1 binding likely by increasing the affinity for thepotassium ions. When hydroxylated at C-3 of 'Lys-22'by JMJD7, may bind to RNA and play a role in translation. Binds to microtubules and promotesmicrotubule polymerization and stability that are required for mitoticspindle assembly during prophase to anaphase transition. GTPaseactivity is not necessary for these microtubule-related functions. [1-4]
    Click to Show/Hide
  3D Structure

Function of This Protein During Virus Infection
Virus NameSARS-COV-2 Protein Function Pro-viral [5]
Infected TissueKidney Infection Time48 h
Infected Cellvero e6 cells(African green monkey kidny cell) Cellosaurus IDCVCL_YZ66 
Method DescriptionTo detect the role of host protein DRG1 in viral infection, DRG1 protein knockout vero e6 cells(African green monkey kidny cell) were infected with SARS-COV-2 for 48 h , and the effects on infection was detected through Kit.
ResultsIt is reported that Knockdown of DRG1 leads to the reduced SARS-CoV-2 RNA levels compared with control group.

Host Protein - Virus RNA Network

 Full List of Virus RNA Interacting with This Protien
            RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Not Specified Virus Strain
              RNA Binding Region
ORF10
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Calu-3 cells (Human Lung Cancer Cell)  (CVCL_0609 )
              Cell Originated Tissue Liver
              Interaction Score P-value < 0.05
              Method Description RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS)
           RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [7]
              Strains Name
hCoV-19/England/02/2020
              Strains Family
Beta (B.1.351)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Calu-3 cells (Human lung cancer cell) Calu-3 cells (Human lung cancer cell)  (CVCL_0609 )
              Cell Originated Tissue Lung
              Infection Time 24 h
              Interaction Score P-adjust = 0.004
              Method Description UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
Picture Not Found

Protein Sequence Information
MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK
    Click to Show/Hide

References
1 The Jumonji-C oxygenase JMJD7 catalyzes (3S)-lysyl hydroxylation of TRAFAC GTPases. Nat Chem Biol. 2018 Jul;14(7):688-695.
2 Developmentally Regulated GTP binding protein 1 (DRG1) controls microtubule dynamics. Sci Rep. 2017 Aug 30;7(1):9996.
3 Human Drg1 is a potassium-dependent GTPase enhanced by Lerepo4. FEBS J. 2013 Aug;280(15):3647-57.
4 Independent stabilizations of polysomal Drg1/Dfrp1 complex and non-polysomal Drg2/Dfrp2 complex in mammalian cells. Biochem Biophys Res Commun. 2009 Dec 18;390(3):552-6.
5 Functional interrogation of a SARS-CoV-2 host protein interactome identifies unique and shared coronavirus host factors. Cell Host Microbe. 2021 Feb 10;29(2):267-280.e5.
6 Mapping the host protein interactome of non-coding regions in SARS-CoV-2 genome. bioRxiv. 2021 Jun; DOI:10.1101/2021.06.19.449092.
7 Global analysis of protein-RNA interactions in SARS-CoV-2-infected cells reveals key regulators of infection. Mol Cell. 2021 Jul 1;81(13):2851-2867.e7.