Details of Host Protein
Host Protein General Information (ID: PT0680) | |||||||||
---|---|---|---|---|---|---|---|---|---|
Protein Name |
Nuclear cap-binding protein subunit 2 (NCBP2)
|
Gene Name |
NCBP2
|
||||||
Host Species |
Homo sapiens
|
Uniprot Entry Name |
NCBP2_HUMAN
|
||||||
Protein Families |
RRM NCBP2 family
|
||||||||
Subcellular Location |
Nucleus Cytoplasm
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Function in Host |
Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in variousprocesses such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA exportfrom the nucleus via its interaction with ALYREF/THOC4/ALY, leading tothe recruitment of the mRNA export machinery to the 5' end of mRNA andto mRNA export in a 5' to 3' direction through the nuclear pore. TheCBC complex is also involved in mediating U snRNA and intronless mRNAsexport from the nucleus. The CBC complex is essential for a pioneerround of mRNA translation, before steady state translation when the CBCcomplex is replaced by cytoplasmic cap-binding protein eIF4E. Thepioneer round of mRNA translation mediated by the CBC complex plays acentral role in nonsense-mediated mRNA decay (NMD), NMD only takingplace in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC) via its interaction with UPF1, promoting theinteraction between UPF1 and UPF2. The CBC complex is also involved in'failsafe' NMD, which is independent of the EJC complex, while it doesnot participate in Staufen-mediated mRNA decay (SMD). During cellproliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with SRRT/ARS2, thereby being requiredfor miRNA-mediated RNA interference. The CBC complex also acts as anegative regulator of PARN, thereby acting as an inhibitor of mRNAdeadenylation. In the CBC complex, NCBP2/CBP20 recognizes and bindscapped RNAs (m7GpppG-capped RNA) but requires NCBP1/CBP80 to stabilizethe movement of its N-terminal loop and lock the CBC into a highaffinity cap-binding state with the cap structure. The conventionalcap-binding complex with NCBP2 binds both small nuclear RNA (snRNA) andmessenger (mRNA) and is involved in their export from the nucleus.
[1-8]
Click to Show/Hide
|
||||||||
Related KEGG Pathway | |||||||||
Nucleocytoplasmic transport | hsa03013 |
Pathway Map ![]() |
|||||||
mRNA surveillance pathway | hsa03015 |
Pathway Map ![]() |
|||||||
Spliceosome | hsa03040 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Function of This Protein During Virus Infection | |||||||||
---|---|---|---|---|---|---|---|---|---|
Virus Name | SARS-COV-2 | Protein Function | Anti-viral | [9] | |||||
Infected Tissue | Lung | Infection Time | 7-9 Days | ||||||
Infected Cell | Calu-3 Cells (Human epithelial cell line) | Cellosaurus ID | CVCL_0609 | ||||||
Method Description | To detect the role of host protein NCBP2 in viral infection, NCBP2 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen. | ||||||||
Results | It is reported that knockout of NCBP2 increases SARS-CoV-2 RNA levels compared with control group. |
Host Protein - Virus RNA Network | |||||||||
---|---|---|---|---|---|---|---|---|---|
Full List of Virus RNA Interacting with This Protien | |||||||||
---|---|---|---|---|---|---|---|---|---|
RNA Region: 3'-UTR (hCoV-SARS/Manitoba/2003 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[10] | |||||||
Strains Name |
hCoV-SARS/Manitoba/2003
|
||||||||
Strains Family |
Beta
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Severe acute respiratory syndrome-related coronavirus (HCoV-SARS)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 3'-UTR (hCov-OC43/VR-759 Quebec/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[10] | |||||||
Strains Name |
hCov-OC43/VR-759 Quebec/2019
|
||||||||
Strains Family |
Beta
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Human coronavirus OC43 (HCov-OC43)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 3'-UTR (hCov-NL63/Amsterdam/2004 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[10] | |||||||
Strains Name |
hCov-NL63/Amsterdam/2004
|
||||||||
Strains Family |
Alpha
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Human Coronavirus NL63 (HCov-NL63)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 3'-UTR (hCov-MERS/Jeddah/2012 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[10] | |||||||
Strains Name |
hCov-MERS/Jeddah/2012
|
||||||||
Strains Family |
Beta
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Middle East respiratory syndrome-related coronavirus (HCov-MERS)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 3'-UTR (hCoV-HKU1/Hong Kong/2004 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[10] | |||||||
Strains Name |
hCoV-HKU1/Hong Kong/2004
|
||||||||
Strains Family |
Beta
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Human coronavirus HKU1 (HCoV-HKU1)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 3'-UTR (hCov-229E/Würzburg/2000 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[10] | |||||||
Strains Name |
hCov-229E/Würzburg/2000
|
||||||||
Strains Family |
Alpha
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Human coronavirus 229E (HCov-229E)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 3'-UTR (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[10] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[11] | |||||||
Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
RNA Binding Region |
ORF10
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7 cells (human liver cell line) Huh7 cells (human liver cell line) (CVCL_0336 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Interaction Score | P-value < 0.05 | ||||||||
Method Description | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | ||||||||
RNA Region: ORF8 (hCoV-19/Zambia/ZMB-88673/2021 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[10] | |||||||
Strains Name |
hCoV-19/Zambia/ZMB-88673/2021
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF8
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: ORF8 (hCoV-19/Malawi/KRISP-K010154/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[10] | |||||||
Strains Name |
hCoV-19/Malawi/KRISP-K010154/2020
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF8
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: ORF8 (hCoV-19/Eswatini/N2779/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[10] | |||||||
Strains Name |
hCoV-19/Eswatini/N2779/2020
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF8
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm |
Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Protein Sequence Information | ||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
Click to Show/Hide
|