Catalyzes the cis-trans isomerization of proline imidicpeptide bonds in oligopeptides. Exerts a strongchemotactic effect on leukocytes partly through activation of one ofits membrane receptors BSG/CD147, initiating a signaling cascade thatculminates in MAPK/ERK activation. Activates endothelial cells (ECs) in a pro-inflammatory manner bystimulating activation of NF-kappa-B and ERK, JNK and p38 MAP-kinasesand by inducing expression of adhesion molecules including SELE andVCAM1. Induces apoptosis in ECs by promoting theFOXO1-dependent expression of CCL2 and BCL2L11 which are involved in ECchemotaxis and apoptosis. In response to oxidativestress, initiates proapoptotic and antiapoptotic signaling in ECs viaactivation of NF-kappa-B and AKT1 and up-regulation of antiapoptoticprotein BCL2. Negatively regulates MAP3K5/ASK1 kinaseactivity, autophosphorylation and oxidative stress-induced apoptosismediated by MAP3K5/ASK1. Necessary for the assemblyof TARDBP in heterogeneous nuclear ribonucleoprotein (hnRNP) complexesand regulates TARDBP binding to RNA UG repeats and TARDBP-dependentexpression of HDAC6, ATG7 and VCP which are involved in clearance ofprotein aggregates. Plays an important role inplatelet activation and aggregation. Regulates calciummobilization and integrin ITGA2B:ITGB3 bidirectional signaling viaincreased ROS production as well as by facilitating the interactionbetween integrin and the cell cytoskeleton. Bindsheparan sulfate glycosaminoglycans. Inhibitsreplication of influenza A virus (IAV). InhibitsITCH/AIP4-mediated ubiquitination of matrix protein 1 (M1) of IAV byimpairing the interaction of ITCH/AIP4 with M1, followed by thesuppression of the nuclear export of M1, and finally reduction of thereplication of IAV. [1-8]

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE