Details of Host Protein
Host Protein General Information (ID: PT0734) | |||||||||
---|---|---|---|---|---|---|---|---|---|
Protein Name |
Phosphatidylethanolamine-binding protein 1 (PEBP1)
|
Gene Name |
PEBP1
|
||||||
Host Species |
Homo sapiens
|
Uniprot Entry Name |
PEBP1_HUMAN
|
||||||
Protein Families |
Phosphatidylethanolamine-binding protein family
|
||||||||
Subcellular Location |
Cytoplasm
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Function in Host |
Binds ATP, opioids and phosphatidylethanolamine. Has loweraffinity for phosphatidylinositol and phosphatidylcholine. Serineprotease inhibitor which inhibits thrombin, neuropsin and chymotrypsinbut not trypsin, tissue type plasminogen activator and elastase. Inhibits the kinase activity of RAF1 by inhibiting itsactivation and by dissociating the RAF1/MEK complex and acting as acompetitive inhibitor of MEK phosphorylation.
[1]
Click to Show/Hide
|
||||||||
3D Structure |
|
Function of This Protein During Virus Infection | |||||||||
---|---|---|---|---|---|---|---|---|---|
Virus Name | SARS-COV-2 | Protein Function | Pro-viral | [2] | |||||
Infected Tissue | Lung | Infection Time | 7-9 Days | ||||||
Infected Cell | Calu-3 Cells (Human epithelial cell line) | Cellosaurus ID | CVCL_0609 | ||||||
Method Description | To detect the role of host protein PEBP1 in viral infection, PEBP1 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen. | ||||||||
Results | It is reported that knockout of PEBP1 leads to the decreased SARS-CoV-2 RNA levels compared with control group. |
Host Protein - Virus RNA Network | |||||||||
---|---|---|---|---|---|---|---|---|---|
Full List of Virus RNA Interacting with This Protien | |||||||||
---|---|---|---|---|---|---|---|---|---|
RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[3] | |||||||
Strains Name |
hCoV-19/IPBCAMS-YL01/2020
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Unlikely to be direct binder | ||||||||
Infection Cells | Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Infection Time | 30 h | ||||||||
Interaction Score | MIST = 0.685515775 | ||||||||
Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) | ||||||||
RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[4] | |||||||
Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7 cells (liver carcinoma cell) Huh7 cells (liver carcinoma cell) (CVCL_0336 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Infection Time | 24h | ||||||||
Interaction Score | log2FC = 4.07357E+12 | ||||||||
Method Description | RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot | ||||||||
RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[5] | |||||||
Strains Name |
hCoV-19/England/02/2020
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Calu-3 cells (Human lung cancer cell) Calu-3 cells (Human lung cancer cell) (CVCL_0609 ) | ||||||||
Cell Originated Tissue | Lung | ||||||||
Infection Time | 24 h | ||||||||
Interaction Score | P-adjust = 0.056 | ||||||||
Method Description | UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) |
Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
T42
[6] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
T51
[6] |
![]() |
Protein Sequence Information |
MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
Click to Show/Hide
|
---|