Details of Host Protein

Host Protein General Information (ID: PT0878)
Protein Name	Putative methyltransferase C9orf114 (SHROOM4)	Gene Name	SPOUT1
Host Species	Homo sapiens	Uniprot Entry Name	CI114_HUMAN
Protein Families	Class IV-like SAM-binding methyltransferase superfamily
EC Number	2.1.1.-
Subcellular Location	Cytoplasm; cytoskeleton; spindle Chromosome
External Link
	NCBI Gene ID	51490
	Uniprot ID	Q5T280
	Ensembl ID	ENSG00000158352
	HGNC ID	HGNC:26933
Function in Host	Required for association of the centrosomes with the poles ofthe bipolar mitotic spindle during metaphase. Also involved in chromosome alignment. May promote centrosome maturation probably byrecruiting A-kinase anchor protein AKAP9 to centrosomes in earlymitosis. Binds specifically to miRNA MIR145 hairpin, regulates MIR145 expression at a postranscriptional level. [1-3] Click to Show/Hide
3D Structure	PDB ID: 4RG1 FASTA Download 2D PNG Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Anti-viral	[4]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein SPOUT1 in viral infection, SPOUT1 protein Knockdown Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of SPOUT1 increases SARS-CoV-2 RNA levels compared with control group.

Host Protein - Virus RNA Network

Network Download

Full List of Virus RNA Interacting with This Protien
*RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[5]
Strains Name	hCoV-19/Not Specified Virus Strain
RNA Binding Region	ORF10
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Huh7 cells (human liver cell line) (CVCL_0336 )
Cell Originated Tissue	Liver
Interaction Score	P-value < 0.05
Method Description	RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS)
*RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[6]
Strains Name	hCoV-19/England/02/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Calu-3 cells (Human lung cancer cell) Calu-3 cells (Human lung cancer cell) (CVCL_0609 )
Cell Originated Tissue	Lung
Infection Time	24 h
Interaction Score	P-adjust = 0.090
Method Description	UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Sequence Information
MAERGRKRPCGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLIQAGARHT Click to Show/Hide

References
1	A Compendium of RNA-Binding Proteins that Regulate MicroRNA Biogenesis. Mol Cell. 2017 Apr 20;66(2):270-284.e13.
2	CENP-32 is required to maintain centrosomal dominance in bipolar spindle assembly. Mol Biol Cell. 2015 Apr 1;26(7):1225-37.
3	The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics. Cell. 2010 Sep 3;142(5):810-21.
4	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
5	Mapping the host protein interactome of non-coding regions in SARS-CoV-2 genome. bioRxiv. 2021 Jun; DOI:10.1101/2021.06.19.449092.
6	Global analysis of protein-RNA interactions in SARS-CoV-2-infected cells reveals key regulators of infection. Mol Cell. 2021 Jul 1;81(13):2851-2867.e7.