Details of Host Protein

 Host Protein General Information (ID: PT0945)
  Protein Name
Ribosome maturation protein SBDS (SBDS)
  Gene Name
SBDS
  Host Species
Homo sapiens
  Uniprot Entry Name
SBDS_HUMAN
  Protein Families
SDO1/SBDS family
  Subcellular Location
Cytoplasm
  External Link
NCBI Gene ID
51119
Uniprot ID
Q9Y3A5
Ensembl ID
ENSG00000126524
HGNC ID
HGNC:19440
  Function in Host
Required for the assembly of mature ribosomes and ribosomebiogenesis. Together with EFL1, triggers the GTP-dependent release ofEIF6 from 60S pre-ribosomes in the cytoplasm, thereby activatingribosomes for translation competence by allowing 80S ribosome assemblyand facilitating EIF6 recycling to the nucleus, where it is requiredfor 60S rRNA processing and nuclear export. Required for normal levelsof protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role incell proliferation. [1-4]
    Click to Show/Hide
  Related KEGG Pathway
Ribosome biogenesis in eukaryotes hsa03008            Pathway Map 
  3D Structure
PDB ID: 2KDO 
FASTA   Download
  2D PNG Download  
PDB File Download

Function of This Protein During Virus Infection
Virus NameSARS-COV-2 Protein Function Anti-viral [5]
Infected TissueLung Infection Time7-9 Days
Infected CellCalu-3 Cells (Human epithelial cell line) Cellosaurus IDCVCL_0609 
Method DescriptionTo detect the role of host protein SBDS in viral infection, SBDS protein Knockdown Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
ResultsIt is reported that knockout of SBDS increases SARS-CoV-2 RNA levels compared with control group.

Host Protein - Virus RNA Network
  Network Download  

 Full List of Virus RNA Interacting with This Protien
            RNA Region: 5'-UTR (hCoV-19/Namibia/N17380/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Namibia/N17380/2021
              Strains Family
Delta (B.1.617.2 and AY lineages)
              RNA Binding Region
5'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: 5'-UTR (hCoV-19/Namibia/CERI-KRISP-K022530/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Namibia/CERI-KRISP-K022530/2021
              Strains Family
Delta (B.1.617.2 and AY lineages)
              RNA Binding Region
5'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: 5'-UTR (hCoV-19/Kyrgyzstan/ChVir26576_10/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Kyrgyzstan/ChVir26576_10/2021
              Strains Family
Delta (B.1.617.2 and AY lineages)
              RNA Binding Region
5'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: 5'-UTR (hCoV-19/Kazakhstan/1872/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Kazakhstan/1872/2021
              Strains Family
Delta (B.1.617.2 and AY lineages)
              RNA Binding Region
5'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: 5'-UTR (hCoV-19/Iraq/Thi-Qar-1/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Iraq/Thi-Qar-1/2021
              Strains Family
Delta (B.1.617.2 and AY lineages)
              RNA Binding Region
5'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: 5'-UTR (hCoV-19/IPBCAMS-YL01/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [7]
              Strains Name
hCoV-19/IPBCAMS-YL01/2020
              Strains Family
Beta (B.1.351)
              RNA Binding Region
5'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_E049 )
              Cell Originated Tissue Liver
              Infection Time 30 h
              Interaction Score Affinity = 0.94
              Method Description PrismNet; pull-down western (STAR methods); Mass spectrometry
           RNA Region: ORF3a (hCoV-19/Namibia/N17380/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Namibia/N17380/2021
              Strains Family
Delta (B.1.617.2 and AY lineages)
              RNA Binding Region
ORF3a
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: ORF3a (hCoV-19/Namibia/CERI-KRISP-K022530/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Namibia/CERI-KRISP-K022530/2021
              Strains Family
Delta (B.1.617.2 and AY lineages)
              RNA Binding Region
ORF3a
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: ORF3a (hCoV-19/Kyrgyzstan/ChVir26576_10/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Kyrgyzstan/ChVir26576_10/2021
              Strains Family
Delta (B.1.617.2 and AY lineages)
              RNA Binding Region
ORF3a
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: ORF3a (hCoV-19/Kazakhstan/1872/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Kazakhstan/1872/2021
              Strains Family
Delta (B.1.617.2 and AY lineages)
              RNA Binding Region
ORF3a
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: ORF3a (hCoV-19/Iraq/Thi-Qar-1/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Iraq/Thi-Qar-1/2021
              Strains Family
Delta (B.1.617.2 and AY lineages)
              RNA Binding Region
ORF3a
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: ORF7a (hCoV-19/Kazakhstan/1872/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Kazakhstan/1872/2021
              Strains Family
Delta (B.1.617.2 and AY lineages)
              RNA Binding Region
ORF7a
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: ORF8 (hCoV-19/Argentina/INEI113521/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Argentina/INEI113521/2021
              Strains Family
Gamma (P.1)
              RNA Binding Region
ORF8
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: N region (hCoV-19/Wuhan-Hu-1/2019 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Wuhan-Hu-1/2019
              Strains Family
Beta (B.1.351)
              RNA Binding Region
N region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: N region (hCoV-19/Venezuela/Bol285/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Venezuela/Bol285/2021
              Strains Family
Gamma (P.1)
              RNA Binding Region
N region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: N region (hCoV-19/Switzerland/TI-EOC-902_25839324/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Switzerland/TI-EOC-902_25839324/2021
              Strains Family
Gamma (P.1)
              RNA Binding Region
N region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: N region (hCoV-19/Suriname/SR-342/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Suriname/SR-342/2021
              Strains Family
Gamma (P.1)
              RNA Binding Region
N region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: N region (hCoV-19/Peru/CAL-INS-5458/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Peru/CAL-INS-5458/2021
              Strains Family
Gamma (P.1)
              RNA Binding Region
N region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: N region (hCoV-19/Argentina/PAIS-E0546/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Argentina/PAIS-E0546/2021
              Strains Family
Gamma (P.1)
              RNA Binding Region
N region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: N region (hCoV-19/Argentina/INEI113521/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Argentina/INEI113521/2021
              Strains Family
Gamma (P.1)
              RNA Binding Region
N region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: N region (hCoV-19/Argentina/INEI106123/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Argentina/INEI106123/2021
              Strains Family
Gamma (P.1)
              RNA Binding Region
N region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: N region (hCoV-19/Argentina/INEI104133/2021 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Argentina/INEI104133/2021
              Strains Family
Gamma (P.1)
              RNA Binding Region
N region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: Not Specified Virus Region (hCoV-SARS/Manitoba/2003 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-SARS/Manitoba/2003
              Strains Family
Beta
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome-related coronavirus (HCoV-SARS)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: Not Specified Virus Region (hCov-OC43/VR-759 Quebec/2019 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCov-OC43/VR-759 Quebec/2019
              Strains Family
Beta
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Human coronavirus OC43 (HCov-OC43)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: Not Specified Virus Region (hCov-NL63/Amsterdam/2004 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCov-NL63/Amsterdam/2004
              Strains Family
Alpha
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Human Coronavirus NL63 (HCov-NL63)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: Not Specified Virus Region (hCov-MERS/Jeddah/2012 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCov-MERS/Jeddah/2012
              Strains Family
Beta
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Middle East respiratory syndrome-related coronavirus (HCov-MERS)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: Not Specified Virus Region (hCoV-HKU1/Hong Kong/2004 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-HKU1/Hong Kong/2004
              Strains Family
Beta
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Human coronavirus HKU1 (HCoV-HKU1)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
           RNA Region: Not Specified Virus Region (hCov-229E/Würzburg/2000 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCov-229E/Würzburg/2000
              Strains Family
Alpha
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Human coronavirus 229E (HCov-229E)
              Interaction Type Potential binding protein
              Infection Cells K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line)  (CVCL_0004 )
              Cell Originated Tissue Bone marrow
              Method Description ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Sequence Information
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
    Click to Show/Hide

References
1 Uncoupling of GTP hydrolysis from eIF6 release on the ribosome causes Shwachman-Diamond syndrome. Genes Dev. 2011 May 1;25(9):917-29.
2 SBDS expression and localization at the mitotic spindle in human myeloid progenitors. PLoS One. 2009 Sep 17;4(9):e7084.
3 Shwachman-Bodian Diamond syndrome is a multi-functional protein implicated in cellular stress responses. Hum Mol Genet. 2009 Oct 1;18(19):3684-95.
4 The Shwachman-Bodian-Diamond syndrome associated protein interacts with HsNip7 and its down-regulation affects gene expression at the transcriptional and translational levels. Exp Cell Res. 2007 Dec 10;313(20):4180-95.
5 Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
6 Computational Mapping of the Human-SARS-CoV-2 Protein-RNA Interactome. bioRxiv. 2021 Dec; DOI:.org/10.1101/2021.12.22.472458.
7 In vivo structural characterization of the SARS-CoV-2 RNA genome identifies host proteins vulnerable to repurposed drugs. Cell. 2021 Apr 1;184(7):1865-1883.e20.