Details of Host Protein

 Host Protein General Information (ID: PT1039)
  Protein Name
Protein phosphatase 1C catalytic subunit (PPP1CC)
  Gene Name
PPP1CC
  Host Species
Homo sapiens
  Uniprot Entry Name
PP1G_HUMAN
  Protein Families
PPP phosphatase family
  EC Number
3.1.3.16
  Subcellular Location
Cytoplasm Nucleus
  External Link
NCBI Gene ID
5501
Uniprot ID
P36873
Ensembl ID
ENSG00000186298
HGNC ID
HGNC:9283
  Function in Host
Protein phosphatase that associates with over 200 regulatoryproteins to form highly specific holoenzymes which dephosphorylatehundreds of biological targets. Protein phosphatase 1 (PP1) isessential for cell division, and participates in the regulation ofglycogen metabolism, muscle contractility and protein synthesis. Dephosphorylates RPS6KB1. Involved in regulation of ionic conductancesand long-term synaptic plasticity. May play an important role indephosphorylating substrates such as the postsynaptic density-associated Ca (2+) /calmodulin dependent protein kinase II. Component ofthe PTW/PP1 phosphatase complex, which plays a role in the control ofchromatin structure and cell cycle progression during the transitionfrom mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of thespeed and rhythmicity of PER1 and PER2 phosphorylation. Maydephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418'residue of FOXP3 in regulatory T-cells (Treg) from patients withrheumatoid arthritis, thereby inactivating FOXP3 and rendering Tregcells functionally defective.
    Click to Show/Hide
  Related KEGG Pathway
mRNA surveillance pathway hsa03015            Pathway Map 
Platelet activation hsa04611            Pathway Map 
Herpes simplex virus 1 infection hsa05168            Pathway Map 
Amphetamine addiction hsa05031            Pathway Map 
Alcoholism hsa05034            Pathway Map 
cGMP-PKG signaling pathway hsa04022            Pathway Map 
cAMP signaling pathway hsa04024            Pathway Map 
Oocyte meiosis hsa04114            Pathway Map 
  3D Structure
PDB ID: 1IT6 
FASTA   Download
  2D PNG Download  
PDB File Download

Function of This Protein During Virus Infection
Virus NameSARS-COV-2 Protein Function Pro-viral [1]
Infected TissueLung Infection Time48 h
Infected CellCalu-3 cells (Human lung cancer cell) Cellosaurus IDCVCL_0609 
Method DescriptionTo detect the role of host protein PPP1CC in viral infection, PPP1CC protein knockout Calu-3 cells were infected with SARS-COV-2 for 48 h , and the effects on infection was detected through qRT-PCR.
ResultsIt is reported that knockdown of PPP1CC leads to the reduced SARS-CoV-2 RNA levels compared with control group.

Host Protein - Virus RNA Network
  Network Download  

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [2]
              Strains Name
hCoV-19/USA/WA1/2020
              Strains Family
Alpha (B.1.1.7)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7.5 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_7927 )
              Cell Originated Tissue Liver
              Infection Time 48 h
              Interaction Score FDR ≤ 0.05
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)
           RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [3]
              Strains Name
hCoV-19/Not Specified Virus Strain
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7 cells (liver carcinoma cell) Huh7 cells (liver carcinoma cell)  (CVCL_0336 )
              Cell Originated Tissue Liver
              Infection Time 24h
              Interaction Score log2FC = 6.65426E+14
              Method Description RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Sequence Information
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK
    Click to Show/Hide

References
1 The SARS-CoV-2 RNA interactome. Mol Cell. 2021 Jul 1;81(13):2838-2850.e6.
2 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.
3 The SARS-CoV-2 RNA-protein interactome in infected human cells. Nat Microbiol. 2021 Mar;6(3):339-353.