Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiationof protein synthesis. The eIF-3 complex associates with the 40S ribosomeand facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). TheeIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanningof the mRNA for AUG recognition. The eIF-3 complex is also required fordisassembly and recycling of post-termination ribosomal complexes andsubsequently prevents premature joining of the 40S and 60S ribosomalsubunits prior to initiation. The eIF-3 complexspecifically targets and initiates translation of a subset of mRNAsinvolved in cell proliferation, including cell cycling, differentiationand apoptosis, and uses different modes of RNA stem-loop binding toexert either translational activation or repression. Required for nonsense-mediated mRNA decay (NMD); may act in conjunctionwith UPF2 to divert mRNAs from translation to the NMD pathway. May interact with MCM7 and EPAS1 and regulate theproteasome-mediated degradation of these proteins. [1-2]

MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY