Zinc-finger RNA-binding protein that destabilizes severalcytoplasmic AU-rich element (ARE) -containing mRNA transcripts bypromoting their poly (A) tail removal or deadenylation, and henceprovide a mechanism for attenuating protein synthesis. Acts as an 3'-untranslated region (UTR) ARE mRNA-binding adapterprotein to communicate signaling events to the mRNA decay machinery. Recruits deadenylase CNOT7 (andprobably the CCR4-NOT complex) via association with CNOT1, and hencepromotes ARE-mediated mRNA deadenylation. Functionsalso by recruiting components of the cytoplasmic RNA decay machinery tothe bound ARE-containing mRNAs. Self regulates by destabilizing itsown mRNA. Binds to 3'-UTR ARE of numerous mRNAs andof its own mRNA. Plays a role in anti-inflammatory responses;suppresses tumor necrosis factor (TNF) -alpha production by stimulatingARE-mediated TNF-alpha mRNA decay and several other inflammatory ARE-containing mRNAs in interferon (IFN) - and/or lipopolysaccharide (LPS) -induced macrophages. Plays also a role in theregulation of dendritic cell maturation at the post-transcriptionallevel, and hence operates as part of a negative feedback loop to limitthe inflammatory response. Promotes ARE-mediated mRNAdecay of hypoxia-inducible factor HIF1A mRNA during the response ofendothelial cells to hypoxia. Positively regulatesearly adipogenesis of preadipocytes by promoting ARE-mediated mRNAdecay of immediate early genes (IEGs). Negativelyregulates hematopoietic/erythroid cell differentiation by promotingARE-mediated mRNA decay of the transcription factor STAT5B mRNA. Plays a role in maintaining skeletal musclesatellite cell quiescence by promoting ARE-mediated mRNA decay of themyogenic determination factor MYOD1 mRNA. Associatesalso with and regulates the expression of non-ARE-containing targetmRNAs at the post-transcriptional level, such as MHC class I mRNAs. Participates in association with argonaute RISCcatalytic components in the ARE-mediated mRNA decay mechanism; assistsmicroRNA (miRNA) targeting ARE-containing mRNAs. Mayalso play a role in the regulation of cytoplasmic mRNA decapping;enhances decapping of ARE-containing RNAs, in vitro. Involved in the delivery of target ARE-mRNAs to processing bodies (PBs). In addition to its cytosolic mRNA-decay function, affects nuclear pre-mRNA processing. Negativelyregulates nuclear poly (A) -binding protein PABPN1-stimulatedpolyadenylation activity on ARE-containing pre-mRNA during LPS-stimulated macrophages. Also involved in the regulationof stress granule (SG) and P-body (PB) formation and fusion. Plays a role in the regulation of keratinocyteproliferation, differentiation and apoptosis. Plays arole as a tumor suppressor by inhibiting cell proliferation in breastcancer cells. [1-5]

MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE