RNA-binding protein that plays several role in the regulationof pre- and post-transcriptional processes. Implicated in tissue-specific regulation of gene transcription and alternative splicing ofseveral pre-mRNAs. Binds to and stimulates transcription from the tumorsuppressor TXNIP gene promoter; may thus be involved in tumorsuppression. When associated with SAFB, binds to and stimulatestranscription from the SREBF1 promoter. Associates with nascent mRNAstranscribed by RNA polymerase II. Component of the supraspliceosomecomplex that regulates pre-mRNA alternative splice site selection. Caneither activate or suppress exon inclusion; acts additively with TRA2Bto promote exon 7 inclusion of the survival motor neuron SMN2. Represses the splicing of MAPT/Tau exon 10. Binds preferentially tosingle-stranded 5'-CC[A/C]-rich RNA sequence motifs localized in asingle-stranded conformation; probably binds RNA as a homodimer. Bindsnon-specifically to pre-mRNAs. Plays also a role in the cytoplasmicTNFR1 trafficking pathways; promotes both the IL-1-beta-mediatedinducible proteolytic cleavage of TNFR1 ectodomains and the release ofTNFR1 exosome-like vesicles to the extracellular compartment.

MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY