Details of Host Protein

Host Protein General Information (ID: PT1285)
Protein Name	Zinc finger protein 622 (ZNF622)	Gene Name	ZNF622
Host Species	Homo sapiens	Uniprot Entry Name	ZN622_HUMAN
Subcellular Location	Cytoplasm Nucleus
External Link
	NCBI Gene ID	90441
	Uniprot ID	Q969S3
	Ensembl ID	ENSG00000173545
	HGNC ID	HGNC:30958
Function in Host	May behave as an activator of the bound transcription factor, MYBL2, and be involved in embryonic development. Click to Show/Hide
3D Structure	PDB ID: 6LQM FASTA Download 2D PNG Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Anti-viral	[1]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein ZNF622 in viral infection, ZNF622 protein Knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of ZNF622 increases SARS-CoV-2 RNA levels compared with control group.

Host Protein - Virus RNA Network

Network Download

Full List of Virus RNA Interacting with This Protien
*RNA Region: 5'-UTR (hCoV-19/Zambia/ZMB-88673/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Zambia/ZMB-88673/2021
Strains Family	Beta (B.1.351)
RNA Binding Region	5'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: 5'-UTR (hCoV-19/Namibia/N17380/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Namibia/N17380/2021
Strains Family	Delta (B.1.617.2 and AY lineages)
RNA Binding Region	5'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: 5'-UTR (hCoV-19/Namibia/CERI-KRISP-K022530/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Namibia/CERI-KRISP-K022530/2021
Strains Family	Delta (B.1.617.2 and AY lineages)
RNA Binding Region	5'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: 5'-UTR (hCoV-19/Malawi/KRISP-K010154/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Malawi/KRISP-K010154/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	5'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: 5'-UTR (hCoV-19/Kyrgyzstan/ChVir26576_10/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Kyrgyzstan/ChVir26576_10/2021
Strains Family	Delta (B.1.617.2 and AY lineages)
RNA Binding Region	5'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: 5'-UTR (hCoV-19/Kazakhstan/1872/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Kazakhstan/1872/2021
Strains Family	Delta (B.1.617.2 and AY lineages)
RNA Binding Region	5'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: 5'-UTR (hCoV-19/Iraq/Thi-Qar-1/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Iraq/Thi-Qar-1/2021
Strains Family	Delta (B.1.617.2 and AY lineages)
RNA Binding Region	5'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: 5'-UTR (hCoV-19/Eswatini/N2779/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Eswatini/N2779/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	5'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Zimbabwe/CERI-KRISP-K034087/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Zimbabwe/CERI-KRISP-K034087/2021
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Wuhan/HBCDC-HB-04/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Wuhan/HBCDC-HB-04/2020
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Venezuela/Bol285/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Venezuela/Bol285/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Switzerland/TI-EOC-902_25839324/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Switzerland/TI-EOC-902_25839324/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Suriname/SR-342/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Suriname/SR-342/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Scotland/QEUH-13A999F/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Scotland/QEUH-13A999F/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Scotland/EDB14267/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Scotland/EDB14267/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Philippines/PH-PGC-104159/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Philippines/PH-PGC-104159/2021
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Peru/CAL-INS-5458/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Peru/CAL-INS-5458/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Myanmar/DSMRC-065/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Myanmar/DSMRC-065/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Malaysia/MGI_GS0622/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Malaysia/MGI_GS0622/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Ethiopia/ILRI_COVM02835/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Ethiopia/ILRI_COVM02835/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/England/QEUH-1269F5E/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/QEUH-1269F5E/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/England/MILK-F88D46/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/MILK-F88D46/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/England/MILK-F88C2B/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/MILK-F88C2B/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/England/MILK-1205929/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/MILK-1205929/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/England/MILK-11F02FA/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/MILK-11F02FA/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/England/LOND-12F444A/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/LOND-12F444A/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/England/CAMC-13B6BB7/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/CAMC-13B6BB7/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/England/CAMC-12DF946/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/CAMC-12DF946/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/ElSalvador/INC-LNSP-153/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/ElSalvador/INC-LNSP-153/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Chile/AT-59206/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Chile/AT-59206/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Canada/UN-276648/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Canada/UN-276648/2021
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Bonaire/BQ-RIVM-101067/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Bonaire/BQ-RIVM-101067/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Bolivia/CH-INLASA-27102/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Bolivia/CH-INLASA-27102/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Bangladesh/CHRF-GSB17-117/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Bangladesh/CHRF-GSB17-117/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Australia/SA60463/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Australia/SA60463/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Argentina/PAIS-E0546/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/PAIS-E0546/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Argentina/INEI113521/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI113521/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Argentina/INEI106123/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI106123/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF1ab (hCoV-19/Argentina/INEI104133/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI104133/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF1ab
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF3a (hCoV-19/Venezuela/Bol285/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Venezuela/Bol285/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF3a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF3a (hCoV-19/Switzerland/TI-EOC-902_25839324/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Switzerland/TI-EOC-902_25839324/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF3a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF3a (hCoV-19/Suriname/SR-342/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Suriname/SR-342/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF3a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF3a (hCoV-19/Peru/CAL-INS-5458/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Peru/CAL-INS-5458/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF3a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF3a (hCoV-19/Bolivia/CH-INLASA-27102/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Bolivia/CH-INLASA-27102/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF3a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF3a (hCoV-19/Argentina/PAIS-E0546/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/PAIS-E0546/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF3a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF3a (hCoV-19/Argentina/INEI113521/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI113521/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF3a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF3a (hCoV-19/Argentina/INEI106123/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI106123/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF3a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF3a (hCoV-19/Argentina/INEI104133/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI104133/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF3a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF7a (hCoV-19/Namibia/N17380/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Namibia/N17380/2021
Strains Family	Delta (B.1.617.2 and AY lineages)
RNA Binding Region	ORF7a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF7a (hCoV-19/Namibia/CERI-KRISP-K022530/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Namibia/CERI-KRISP-K022530/2021
Strains Family	Delta (B.1.617.2 and AY lineages)
RNA Binding Region	ORF7a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF7a (hCoV-19/Kazakhstan/1872/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Kazakhstan/1872/2021
Strains Family	Delta (B.1.617.2 and AY lineages)
RNA Binding Region	ORF7a
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF8 (hCoV-19/Zambia/ZMB-88673/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Zambia/ZMB-88673/2021
Strains Family	Beta (B.1.351)
RNA Binding Region	ORF8
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF8 (hCoV-19/Venezuela/Bol285/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Venezuela/Bol285/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF8
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF8 (hCoV-19/Switzerland/TI-EOC-902_25839324/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Switzerland/TI-EOC-902_25839324/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF8
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF8 (hCoV-19/Malawi/KRISP-K010154/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Malawi/KRISP-K010154/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	ORF8
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF8 (hCoV-19/Eswatini/N2779/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Eswatini/N2779/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	ORF8
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF8 (hCoV-19/Bolivia/CH-INLASA-27102/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Bolivia/CH-INLASA-27102/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF8
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF8 (hCoV-19/Argentina/PAIS-E0546/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/PAIS-E0546/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF8
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF8 (hCoV-19/Argentina/INEI113521/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI113521/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF8
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: ORF8 (hCoV-19/Argentina/INEI106123/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI106123/2021
Strains Family	Gamma (P.1)
RNA Binding Region	ORF8
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Zimbabwe/CERI-KRISP-K034087/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Zimbabwe/CERI-KRISP-K034087/2021
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Wuhan/HBCDC-HB-04/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Wuhan/HBCDC-HB-04/2020
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Wuhan-Hu-1/2019 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Wuhan-Hu-1/2019
Strains Family	Beta (B.1.351)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Venezuela/Bol285/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Venezuela/Bol285/2021
Strains Family	Gamma (P.1)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Switzerland/TI-EOC-902_25839324/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Switzerland/TI-EOC-902_25839324/2021
Strains Family	Gamma (P.1)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Suriname/SR-342/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Suriname/SR-342/2021
Strains Family	Gamma (P.1)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Scotland/QEUH-13A999F/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Scotland/QEUH-13A999F/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Scotland/EDB14267/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Scotland/EDB14267/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Philippines/PH-PGC-104159/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Philippines/PH-PGC-104159/2021
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Peru/CAL-INS-5458/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Peru/CAL-INS-5458/2021
Strains Family	Gamma (P.1)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Myanmar/DSMRC-065/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Myanmar/DSMRC-065/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Malaysia/MGI_GS0622/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Malaysia/MGI_GS0622/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Ethiopia/ILRI_COVM02835/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Ethiopia/ILRI_COVM02835/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/England/QEUH-1269F5E/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/QEUH-1269F5E/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/England/MILK-F88D46/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/MILK-F88D46/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/England/MILK-F88C2B/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/MILK-F88C2B/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/England/MILK-1205929/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/MILK-1205929/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/England/MILK-11F02FA/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/MILK-11F02FA/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/England/LOND-12F444A/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/LOND-12F444A/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/England/CAMC-13B6BB7/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/CAMC-13B6BB7/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/England/CAMC-12DF946/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/England/CAMC-12DF946/2021
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/ElSalvador/INC-LNSP-153/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/ElSalvador/INC-LNSP-153/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Chile/AT-59206/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Chile/AT-59206/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Canada/UN-276648/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Canada/UN-276648/2021
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Bonaire/BQ-RIVM-101067/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Bonaire/BQ-RIVM-101067/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Bangladesh/CHRF-GSB17-117/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Bangladesh/CHRF-GSB17-117/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Australia/SA60463/2022 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Australia/SA60463/2022
Strains Family	Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Argentina/PAIS-E0546/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/PAIS-E0546/2021
Strains Family	Gamma (P.1)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Argentina/INEI113521/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI113521/2021
Strains Family	Gamma (P.1)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Argentina/INEI106123/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI106123/2021
Strains Family	Gamma (P.1)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: N region (hCoV-19/Argentina/INEI104133/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI104133/2021
Strains Family	Gamma (P.1)
RNA Binding Region	N region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: S region (hCoV-19/Venezuela/Bol285/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Venezuela/Bol285/2021
Strains Family	Gamma (P.1)
RNA Binding Region	S region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: S region (hCoV-19/Switzerland/TI-EOC-902_25839324/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Switzerland/TI-EOC-902_25839324/2021
Strains Family	Gamma (P.1)
RNA Binding Region	S region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: S region (hCoV-19/Suriname/SR-342/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Suriname/SR-342/2021
Strains Family	Gamma (P.1)
RNA Binding Region	S region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: S region (hCoV-19/Peru/CAL-INS-5458/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Peru/CAL-INS-5458/2021
Strains Family	Gamma (P.1)
RNA Binding Region	S region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: S region (hCoV-19/Bolivia/CH-INLASA-27102/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Bolivia/CH-INLASA-27102/2021
Strains Family	Gamma (P.1)
RNA Binding Region	S region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: S region (hCoV-19/Bolivia/CH-INLASA-27102/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Bolivia/CH-INLASA-27102/2021
Strains Family	Gamma (P.1)
RNA Binding Region	S region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: S region (hCoV-19/Argentina/PAIS-E0546/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/PAIS-E0546/2021
Strains Family	Gamma (P.1)
RNA Binding Region	S region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: S region (hCoV-19/Argentina/INEI113521/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI113521/2021
Strains Family	Gamma (P.1)
RNA Binding Region	S region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: S region (hCoV-19/Argentina/INEI104133/2021 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Argentina/INEI104133/2021
Strains Family	Gamma (P.1)
RNA Binding Region	S region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: Not Specified Virus Region (hCoV-SARS/Manitoba/2003 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-SARS/Manitoba/2003
Strains Family	Beta
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome-related coronavirus (HCoV-SARS)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: Not Specified Virus Region (hCov-OC43/VR-759 Quebec/2019 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCov-OC43/VR-759 Quebec/2019
Strains Family	Beta
RNA Binding Region	Not Specified Virus Region
Virus Name	Human coronavirus OC43 (HCov-OC43)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: Not Specified Virus Region (hCov-NL63/Amsterdam/2004 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCov-NL63/Amsterdam/2004
Strains Family	Alpha
RNA Binding Region	Not Specified Virus Region
Virus Name	Human Coronavirus NL63 (HCov-NL63)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: Not Specified Virus Region (hCov-MERS/Jeddah/2012 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCov-MERS/Jeddah/2012
Strains Family	Beta
RNA Binding Region	Not Specified Virus Region
Virus Name	Middle East respiratory syndrome-related coronavirus (HCov-MERS)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: Not Specified Virus Region (hCoV-HKU1/Hong Kong/2004 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-HKU1/Hong Kong/2004
Strains Family	Beta
RNA Binding Region	Not Specified Virus Region
Virus Name	Human coronavirus HKU1 (HCoV-HKU1)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: Not Specified Virus Region (hCov-229E/Würzburg/2000 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCov-229E/Würzburg/2000
Strains Family	Alpha
RNA Binding Region	Not Specified Virus Region
Virus Name	Human coronavirus 229E (HCov-229E)
Interaction Type	Potential binding protein
Infection Cells	K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 )
Cell Originated Tissue	Bone marrow
Method Description	ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm
*RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[3]
Strains Name	hCoV-19/England/02/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Calu-3 cells (Human lung cancer cell) Calu-3 cells (Human lung cancer cell) (CVCL_0609 )
Cell Originated Tissue	Lung
Infection Time	24 h
Interaction Score	P-adjust = 0.043
Method Description	UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Phosphorylation after Virus Infection
S143 [4] PNG Download
S143 [5] PNG Download

Protein Sequence Information
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAKKLAKQQEEDSEEEEEDLDGDDWEDIDSDEELECEDTEAMDDVVEQDAEEEEAEEGPPLGAIPITDCLFCSHHSSSLMKNVAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGEDPNKAEELPSEKNLEYDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVGRVLQQYRALGWTGSTGAALMRERDMQYVQRMKSKWMLKTGMKNNATKQMHFRVQVRF Click to Show/Hide

References
1	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
2	Computational Mapping of the Human-SARS-CoV-2 Protein-RNA Interactome. bioRxiv. 2021 Dec; DOI:.org/10.1101/2021.12.22.472458.
3	Global analysis of protein-RNA interactions in SARS-CoV-2-infected cells reveals key regulators of infection. Mol Cell. 2021 Jul 1;81(13):2851-2867.e7.
4	The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.
5	Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.

Details of Host Protein

Cite CovInter

About CovInter

Correspondence