Details of Host Protein
| Host Protein General Information (ID: PT1285) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Protein Name |
Zinc finger protein 622 (ZNF622)
|
Gene Name |
ZNF622
|
||||||
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
ZN622_HUMAN
|
||||||
| Subcellular Location |
Cytoplasm Nucleus
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Function in Host |
May behave as an activator of the bound transcription factor, MYBL2, and be involved in embryonic development.
Click to Show/Hide
|
||||||||
| 3D Structure |
|
||||||||
| Function of This Protein During Virus Infection | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Virus Name | SARS-COV-2 | Protein Function | Anti-viral | [1] | |||||
| Infected Tissue | Lung | Infection Time | 7-9 Days | ||||||
| Infected Cell | Calu-3 Cells (Human epithelial cell line) | Cellosaurus ID | CVCL_0609 | ||||||
| Method Description | To detect the role of host protein ZNF622 in viral infection, ZNF622 protein Knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen. | ||||||||
| Results | It is reported that knockout of ZNF622 increases SARS-CoV-2 RNA levels compared with control group. | ||||||||
| Host Protein - Virus RNA Network | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Full List of Virus RNA Interacting with This Protien | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| RNA Region: 5'-UTR (hCoV-19/Zambia/ZMB-88673/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Zambia/ZMB-88673/2021
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
5'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 5'-UTR (hCoV-19/Namibia/N17380/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Namibia/N17380/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
5'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 5'-UTR (hCoV-19/Namibia/CERI-KRISP-K022530/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Namibia/CERI-KRISP-K022530/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
5'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 5'-UTR (hCoV-19/Malawi/KRISP-K010154/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Malawi/KRISP-K010154/2020
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
5'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 5'-UTR (hCoV-19/Kyrgyzstan/ChVir26576_10/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Kyrgyzstan/ChVir26576_10/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
5'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 5'-UTR (hCoV-19/Kazakhstan/1872/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Kazakhstan/1872/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
5'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 5'-UTR (hCoV-19/Iraq/Thi-Qar-1/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Iraq/Thi-Qar-1/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
5'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 5'-UTR (hCoV-19/Eswatini/N2779/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Eswatini/N2779/2020
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
5'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Zimbabwe/CERI-KRISP-K034087/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Zimbabwe/CERI-KRISP-K034087/2021
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Wuhan/HBCDC-HB-04/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Wuhan/HBCDC-HB-04/2020
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Venezuela/Bol285/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Venezuela/Bol285/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Switzerland/TI-EOC-902_25839324/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Switzerland/TI-EOC-902_25839324/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Suriname/SR-342/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Suriname/SR-342/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Scotland/QEUH-13A999F/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Scotland/QEUH-13A999F/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Scotland/EDB14267/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Scotland/EDB14267/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Philippines/PH-PGC-104159/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Philippines/PH-PGC-104159/2021
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Peru/CAL-INS-5458/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Peru/CAL-INS-5458/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Myanmar/DSMRC-065/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Myanmar/DSMRC-065/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Malaysia/MGI_GS0622/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Malaysia/MGI_GS0622/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Ethiopia/ILRI_COVM02835/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Ethiopia/ILRI_COVM02835/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/England/QEUH-1269F5E/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/QEUH-1269F5E/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/England/MILK-F88D46/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/MILK-F88D46/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/England/MILK-F88C2B/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/MILK-F88C2B/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/England/MILK-1205929/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/MILK-1205929/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/England/MILK-11F02FA/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/MILK-11F02FA/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/England/LOND-12F444A/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/LOND-12F444A/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/England/CAMC-13B6BB7/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/CAMC-13B6BB7/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/England/CAMC-12DF946/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/CAMC-12DF946/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/ElSalvador/INC-LNSP-153/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/ElSalvador/INC-LNSP-153/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Chile/AT-59206/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Chile/AT-59206/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Canada/UN-276648/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Canada/UN-276648/2021
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Bonaire/BQ-RIVM-101067/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Bonaire/BQ-RIVM-101067/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Bolivia/CH-INLASA-27102/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Bolivia/CH-INLASA-27102/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Bangladesh/CHRF-GSB17-117/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Bangladesh/CHRF-GSB17-117/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Australia/SA60463/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Australia/SA60463/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Argentina/PAIS-E0546/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/PAIS-E0546/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Argentina/INEI113521/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI113521/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Argentina/INEI106123/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI106123/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF1ab (hCoV-19/Argentina/INEI104133/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI104133/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF3a (hCoV-19/Venezuela/Bol285/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Venezuela/Bol285/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF3a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF3a (hCoV-19/Switzerland/TI-EOC-902_25839324/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Switzerland/TI-EOC-902_25839324/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF3a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF3a (hCoV-19/Suriname/SR-342/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Suriname/SR-342/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF3a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF3a (hCoV-19/Peru/CAL-INS-5458/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Peru/CAL-INS-5458/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF3a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF3a (hCoV-19/Bolivia/CH-INLASA-27102/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Bolivia/CH-INLASA-27102/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF3a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF3a (hCoV-19/Argentina/PAIS-E0546/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/PAIS-E0546/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF3a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF3a (hCoV-19/Argentina/INEI113521/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI113521/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF3a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF3a (hCoV-19/Argentina/INEI106123/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI106123/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF3a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF3a (hCoV-19/Argentina/INEI104133/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI104133/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF3a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF7a (hCoV-19/Namibia/N17380/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Namibia/N17380/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
ORF7a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF7a (hCoV-19/Namibia/CERI-KRISP-K022530/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Namibia/CERI-KRISP-K022530/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
ORF7a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF7a (hCoV-19/Kazakhstan/1872/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Kazakhstan/1872/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
ORF7a
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF8 (hCoV-19/Zambia/ZMB-88673/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Zambia/ZMB-88673/2021
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
ORF8
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF8 (hCoV-19/Venezuela/Bol285/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Venezuela/Bol285/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF8
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF8 (hCoV-19/Switzerland/TI-EOC-902_25839324/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Switzerland/TI-EOC-902_25839324/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF8
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF8 (hCoV-19/Malawi/KRISP-K010154/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Malawi/KRISP-K010154/2020
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
ORF8
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF8 (hCoV-19/Eswatini/N2779/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Eswatini/N2779/2020
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
ORF8
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF8 (hCoV-19/Bolivia/CH-INLASA-27102/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Bolivia/CH-INLASA-27102/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF8
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF8 (hCoV-19/Argentina/PAIS-E0546/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/PAIS-E0546/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF8
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF8 (hCoV-19/Argentina/INEI113521/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI113521/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF8
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: ORF8 (hCoV-19/Argentina/INEI106123/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI106123/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
ORF8
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Zimbabwe/CERI-KRISP-K034087/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Zimbabwe/CERI-KRISP-K034087/2021
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Wuhan/HBCDC-HB-04/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Wuhan/HBCDC-HB-04/2020
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Venezuela/Bol285/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Venezuela/Bol285/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Switzerland/TI-EOC-902_25839324/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Switzerland/TI-EOC-902_25839324/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Suriname/SR-342/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Suriname/SR-342/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Scotland/QEUH-13A999F/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Scotland/QEUH-13A999F/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Scotland/EDB14267/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Scotland/EDB14267/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Philippines/PH-PGC-104159/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Philippines/PH-PGC-104159/2021
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Peru/CAL-INS-5458/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Peru/CAL-INS-5458/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Myanmar/DSMRC-065/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Myanmar/DSMRC-065/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Malaysia/MGI_GS0622/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Malaysia/MGI_GS0622/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Ethiopia/ILRI_COVM02835/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Ethiopia/ILRI_COVM02835/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/England/QEUH-1269F5E/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/QEUH-1269F5E/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/England/MILK-F88D46/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/MILK-F88D46/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/England/MILK-F88C2B/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/MILK-F88C2B/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/England/MILK-1205929/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/MILK-1205929/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/England/MILK-11F02FA/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/MILK-11F02FA/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/England/LOND-12F444A/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/LOND-12F444A/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/England/CAMC-13B6BB7/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/CAMC-13B6BB7/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/England/CAMC-12DF946/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/England/CAMC-12DF946/2021
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/ElSalvador/INC-LNSP-153/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/ElSalvador/INC-LNSP-153/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Chile/AT-59206/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Chile/AT-59206/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Canada/UN-276648/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Canada/UN-276648/2021
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Bonaire/BQ-RIVM-101067/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Bonaire/BQ-RIVM-101067/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Bangladesh/CHRF-GSB17-117/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Bangladesh/CHRF-GSB17-117/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Australia/SA60463/2022 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Australia/SA60463/2022
|
||||||||
| Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Argentina/PAIS-E0546/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/PAIS-E0546/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Argentina/INEI113521/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI113521/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Argentina/INEI106123/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI106123/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: N region (hCoV-19/Argentina/INEI104133/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI104133/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Venezuela/Bol285/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Venezuela/Bol285/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Switzerland/TI-EOC-902_25839324/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Switzerland/TI-EOC-902_25839324/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Suriname/SR-342/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Suriname/SR-342/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Peru/CAL-INS-5458/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Peru/CAL-INS-5458/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Bolivia/CH-INLASA-27102/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Bolivia/CH-INLASA-27102/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Bolivia/CH-INLASA-27102/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Bolivia/CH-INLASA-27102/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Argentina/PAIS-E0546/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/PAIS-E0546/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Argentina/INEI113521/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI113521/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Argentina/INEI104133/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/Argentina/INEI104133/2021
|
||||||||
| Strains Family |
Gamma (P.1)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: Not Specified Virus Region (hCoV-SARS/Manitoba/2003 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-SARS/Manitoba/2003
|
||||||||
| Strains Family |
Beta
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome-related coronavirus (HCoV-SARS)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: Not Specified Virus Region (hCov-OC43/VR-759 Quebec/2019 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCov-OC43/VR-759 Quebec/2019
|
||||||||
| Strains Family |
Beta
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Human coronavirus OC43 (HCov-OC43)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: Not Specified Virus Region (hCov-NL63/Amsterdam/2004 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCov-NL63/Amsterdam/2004
|
||||||||
| Strains Family |
Alpha
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Human Coronavirus NL63 (HCov-NL63)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: Not Specified Virus Region (hCov-MERS/Jeddah/2012 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCov-MERS/Jeddah/2012
|
||||||||
| Strains Family |
Beta
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Middle East respiratory syndrome-related coronavirus (HCov-MERS)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: Not Specified Virus Region (hCoV-HKU1/Hong Kong/2004 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-HKU1/Hong Kong/2004
|
||||||||
| Strains Family |
Beta
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Human coronavirus HKU1 (HCoV-HKU1)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: Not Specified Virus Region (hCov-229E/Würzburg/2000 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCov-229E/Würzburg/2000
|
||||||||
| Strains Family |
Alpha
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Human coronavirus 229E (HCov-229E)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | K562 cells (Human leukemic cell line) K562 cells (Human leukemic cell line) (CVCL_0004 ) | ||||||||
| Cell Originated Tissue | Bone marrow | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[3] | |||||||
| Strains Name |
hCoV-19/England/02/2020
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Calu-3 cells (Human lung cancer cell) Calu-3 cells (Human lung cancer cell) (CVCL_0609 ) | ||||||||
| Cell Originated Tissue | Lung | ||||||||
| Infection Time | 24 h | ||||||||
| Interaction Score | P-adjust = 0.043 | ||||||||
| Method Description | UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) | ||||||||
| Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
S143
[4] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
S143
[5] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Sequence Information |
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAKKLAKQQEEDSEEEEEDLDGDDWEDIDSDEELECEDTEAMDDVVEQDAEEEEAEEGPPLGAIPITDCLFCSHHSSSLMKNVAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGEDPNKAEELPSEKNLEYDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVGRVLQQYRALGWTGSTGAALMRERDMQYVQRMKSKWMLKTGMKNNATKQMHFRVQVRF
Click to Show/Hide
|
|---|






