Details of Host Protein
Host Protein General Information (ID: PT0996) | |||||||||
---|---|---|---|---|---|---|---|---|---|
Protein Name |
RNA-splicing ligase RtcB homolog (RTCB)
|
Gene Name |
RTCB
|
||||||
Host Species |
Homo sapiens
|
Uniprot Entry Name |
RTCB_HUMAN
|
||||||
Protein Families |
RtcB family
|
||||||||
EC Number |
6.5.1.8
|
||||||||
Subcellular Location |
Nucleus Cytoplasm
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Function in Host |
Catalytic subunit of the tRNA-splicing ligase complex thatacts by directly joining spliced tRNA halves to mature-sized tRNAs byincorporating the precursor-derived splice junction phosphate into themature tRNA as a canonical 3', 5'-phosphodiester. May act as an RNAligase with broad substrate specificity, and may function toward otherRNAs.
[1-2]
Click to Show/Hide
|
||||||||
3D Structure |
|
Function of This Protein During Virus Infection | |||||||||
---|---|---|---|---|---|---|---|---|---|
Virus Name | HCoV-229E | Protein Function | Anti-viral | [3] | |||||
Infected Tissue | Liver | Infection Time | 4 days | ||||||
Infected Cell | Huh-7.5 Cells (Human hepatocellular carcinoma cells) | Cellosaurus ID | CVCL_7927 | ||||||
Method Description | To detect the role of host protein RTCB in viral infection, RTCB protein knockout Huh-7.5 Cells were infected with HCoV-229E for 4 days , and the effects on infection was detected through kit. | ||||||||
Results | It is reported that Knockout of RTCB increases infection compared with control group. | ||||||||
Virus Name | HCoV-NL63 | Protein Function | Anti-viral | [3] | |||||
Infected Tissue | Liver | Infection Time | 4 days | ||||||
Infected Cell | Huh-7.5 Cells (Human hepatocellular carcinoma cells) | Cellosaurus ID | CVCL_7927 | ||||||
Method Description | To detect the role of host protein RTCB in viral infection, RTCB protein knockout Huh-7.5 Cells were infected with HCoV-NL63 for 4 days , and the effects on infection was detected through kit. | ||||||||
Results | It is reported that Knockout of RTCB increases infection compared with control group. | ||||||||
Virus Name | HCoV-OC43 | Protein Function | Pro-viral | [3] | |||||
Infected Tissue | Liver | Infection Time | 4 days | ||||||
Infected Cell | Huh-7.5 Cells (Human hepatocellular carcinoma cells) | Cellosaurus ID | CVCL_7927 | ||||||
Method Description | To detect the role of host protein RTCB in viral infection, RTCB protein knockout Huh-7.5 Cells were infected with HCoV-OC43 for 4 days , and the effects on infection was detected through kit. | ||||||||
Results | It is reported that Knockout of RTCB leads to the disruption appeared to block infection compared with control group. | ||||||||
Virus Name | SARS-COV-2 | Protein Function | Pro-viral | [4] | |||||
Infected Tissue | Lung | Infection Time | 48 h | ||||||
Infected Cell | Calu-3 cells (Human lung cancer cell) | Cellosaurus ID | CVCL_0609 | ||||||
Method Description | To detect the role of host protein RTCB in viral infection, RTCB protein knockout Calu-3 cells were infected with SARS-COV-2 for 48 h , and the effects on infection was detected through qRT-PCR. | ||||||||
Results | It is reported that knockdown of RTCB leads to the reduced SARS-CoV-2 RNA levels compared with control group. |
Host Protein - Virus RNA Network | |||||||||
---|---|---|---|---|---|---|---|---|---|
Full List of Virus RNA Interacting with This Protien | |||||||||
---|---|---|---|---|---|---|---|---|---|
RNA Region: 3'-UTR (hCoV-19/Not Specified Virus Strain ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[5] | |||||||
Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7 cells (human liver cell line); Calu-3 cells (human lung cancer cell line) (CVCL_0336;CVCL_0609 ) | ||||||||
Cell Originated Tissue | Liver; Lung | ||||||||
Interaction Score | P-value < 0.05 | ||||||||
Method Description | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | ||||||||
RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[6] | |||||||
Strains Name |
hCoV-19/IPBCAMS-YL01/2020
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Infection Time | 30 h | ||||||||
Interaction Score | Affinity = 0.928 | ||||||||
Method Description | PrismNet; pull-down western (STAR methods); Mass spectrometry | ||||||||
RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[5] | |||||||
Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
RNA Binding Region |
ORF10
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7 cells (human liver cell line) Huh7 cells (human liver cell line) (CVCL_0336 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Interaction Score | P-value < 0.05 | ||||||||
Method Description | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | ||||||||
RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/USA/WA1/2020
|
||||||||
Strains Family |
Alpha (B.1.1.7)
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_7927 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Infection Time | 48 h | ||||||||
Interaction Score | FDR ≤ 0.05 | ||||||||
Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) | ||||||||
RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[8] | |||||||
Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7 cells (liver carcinoma cell) Huh7 cells (liver carcinoma cell) (CVCL_0336 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Infection Time | 24h | ||||||||
Interaction Score | log2FC = 1.88722E+14 | ||||||||
Method Description | RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot | ||||||||
RNA Region: Not Specified Virus Region (hCoV-19/France/IDF-220-95/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[9] | |||||||
Strains Name |
hCoV-19/France/IDF-220-95/2020
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Direct interaction | ||||||||
Infection Cells | HEK293 Cells (Human embryonic kidney cell) HEK293 Cells (Human embryonic kidney cell) (CVCL_0045 ) | ||||||||
Cell Originated Tissue | Kidney | ||||||||
Infection Time | 48 h | ||||||||
Interaction Score | SAINT score ≥ 0.79 | ||||||||
Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) | ||||||||
RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[10] | |||||||
Strains Name |
hCoV-19/England/02/2020
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Calu-3 cells (Human lung cancer cell) Calu-3 cells (Human lung cancer cell) (CVCL_0609 ) | ||||||||
Cell Originated Tissue | Lung | ||||||||
Infection Time | 8 h | ||||||||
Interaction Score | P-adjust = 0.025 | ||||||||
Method Description | UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) |
Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Protein Sequence Information | ||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVGGFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG
Click to Show/Hide
|