Details of Host Protein
Host Protein General Information (ID: PT0539) | |||||||||
---|---|---|---|---|---|---|---|---|---|
Protein Name |
Heterogeneous nuclear ribonucleoproteins C1/C2 (HNRNPC)
|
Gene Name |
HNRNPC
|
||||||
Host Species |
Homo sapiens
|
Uniprot Entry Name |
HNRPC_HUMAN
|
||||||
Protein Families |
RRM HNRPC family
|
||||||||
Subcellular Location |
Nucleus
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Function in Host |
Binds pre-mRNA and nucleates the assembly of 40S hnRNPparticles. Interacts with poly-U tracts in the 3'-UTRor 5'-UTR of mRNA and modulates the stability and the level oftranslation of bound mRNA molecules. Single HNRNPC tetramers bind 230-240nucleotides. Trimers of HNRNPC tetramers bind 700 nucleotides. May play a role in the early steps of spliceosomeassembly and pre-mRNA splicing. N6-methyladenosine (m6A) has been shownto alter the local structure in mRNAs and long non-coding RNAs (lncRNAs) via a mechanism named 'm (6) A-switch', facilitating binding ofHNRNPC, leading to regulation of mRNA splicing.
[1-5]
Click to Show/Hide
|
||||||||
Related KEGG Pathway | |||||||||
Spliceosome | hsa03040 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Function of This Protein During Virus Infection | |||||||||
---|---|---|---|---|---|---|---|---|---|
Virus Name | SARS-COV-2 | Protein Function | Pro-viral | [6] | |||||
Infected Tissue | Lung | Infection Time | 24h; 36 h | ||||||
Infected Cell | A549 Cells (Adenocarcinomic Human alveolar basal epithelial cells) | Cellosaurus ID | CVCL_H249 | ||||||
Method Description | To detect the role of host protein HNRNPC in viral infection, HNRNPC protein knockout A549 Cells were infected with SARS-COV-2 for 24 - 36 h , and the effects on infection was detected through WB. | ||||||||
Results | It is reported that Knockdown of HNRNPC leads to the decreased infection compared with control group. |
Host Protein - Virus RNA Network | |||||||||
---|---|---|---|---|---|---|---|---|---|
Full List of Virus RNA Interacting with This Protien | |||||||||
---|---|---|---|---|---|---|---|---|---|
RNA Region: 3'-UTR (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[8] | |||||||
Strains Name |
hCoV-19/IPBCAMS-YL01/2020
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Infection Time | 30 h | ||||||||
Interaction Score | Affinity = 0.977 | ||||||||
Method Description | PrismNet; pull-down western (STAR methods); Mass spectrometry | ||||||||
RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[9], [10], [11] | |||||||
Strains Name |
hCoV-19/IPBCAMS-YL01/2020
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
3'-UTR
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | known to be direct binder | ||||||||
Interaction Binding Type | Single stranded RNA binding | ||||||||
Infection Cells | Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Infection Time | 30 h | ||||||||
Interaction Score | MIST = 0.976760585 | ||||||||
Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) | ||||||||
RNA Region: 5'-UTR (hCoV-SARS/Manitoba/2003 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-SARS/Manitoba/2003
|
||||||||
Strains Family |
Beta
|
||||||||
RNA Binding Region |
5'-UTR
|
||||||||
Virus Name |
Severe acute respiratory syndrome-related coronavirus (HCoV-SARS)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 5'-UTR (hCov-OC43/VR-759 Quebec/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCov-OC43/VR-759 Quebec/2019
|
||||||||
Strains Family |
Beta
|
||||||||
RNA Binding Region |
5'-UTR
|
||||||||
Virus Name |
Human coronavirus OC43 (HCov-OC43)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 5'-UTR (hCov-NL63/Amsterdam/2004 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCov-NL63/Amsterdam/2004
|
||||||||
Strains Family |
Alpha
|
||||||||
RNA Binding Region |
5'-UTR
|
||||||||
Virus Name |
Human Coronavirus NL63 (HCov-NL63)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 5'-UTR (hCov-MERS/Jeddah/2012 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCov-MERS/Jeddah/2012
|
||||||||
Strains Family |
Beta
|
||||||||
RNA Binding Region |
5'-UTR
|
||||||||
Virus Name |
Middle East respiratory syndrome-related coronavirus (HCov-MERS)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 5'-UTR (hCoV-HKU1/Hong Kong/2004 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-HKU1/Hong Kong/2004
|
||||||||
Strains Family |
Beta
|
||||||||
RNA Binding Region |
5'-UTR
|
||||||||
Virus Name |
Human coronavirus HKU1 (HCoV-HKU1)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 5'-UTR (hCov-229E/Würzburg/2000 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCov-229E/Würzburg/2000
|
||||||||
Strains Family |
Alpha
|
||||||||
RNA Binding Region |
5'-UTR
|
||||||||
Virus Name |
Human coronavirus 229E (HCov-229E)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: 5'-UTR (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
5'-UTR
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: ORF1ab (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF1ab
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: ORF3a (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF3a
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: ORF6 (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF6
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: ORF7a (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF7a
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: ORF7b (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF7b
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: ORF8 (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
ORF8
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: E region (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
E region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: M region (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
M region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: N region (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
N region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: S region (hCoV-19/Zimbabwe/CERI-KRISP-K034087/2021 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Zimbabwe/CERI-KRISP-K034087/2021
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: S region (hCoV-19/Wuhan/HBCDC-HB-04/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Wuhan/HBCDC-HB-04/2020
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: S region (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
RNA Region: S region (hCoV-19/Philippines/PH-PGC-104159/2021 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Philippines/PH-PGC-104159/2021
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: S region (hCoV-19/Myanmar/DSMRC-065/2022 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Myanmar/DSMRC-065/2022
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: S region (hCoV-19/Malaysia/MGI_GS0622/2022 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Malaysia/MGI_GS0622/2022
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: S region (hCoV-19/Ethiopia/ILRI_COVM02835/2022 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Ethiopia/ILRI_COVM02835/2022
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: S region (hCoV-19/ElSalvador/INC-LNSP-153/2022 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/ElSalvador/INC-LNSP-153/2022
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: S region (hCoV-19/Chile/AT-59206/2022 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Chile/AT-59206/2022
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: S region (hCoV-19/Canada/UN-276648/2021 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Canada/UN-276648/2021
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: S region (hCoV-19/Bonaire/BQ-RIVM-101067/2022 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Bonaire/BQ-RIVM-101067/2022
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: S region (hCoV-19/Bangladesh/CHRF-GSB17-117/2022 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Bangladesh/CHRF-GSB17-117/2022
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: S region (hCoV-19/Australia/SA60463/2022 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[12] | |||||||
Strains Name |
hCoV-19/Australia/SA60463/2022
|
||||||||
Strains Family |
Omicron (B.1.1.529; BA.1; BA.1.1; BA.2; BA.3; BA.4 ; BA.5)
|
||||||||
RNA Binding Region |
S region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Potential binding protein | ||||||||
Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[13] | |||||||
Strains Name |
hCoV-19/USA/WA1/2020
|
||||||||
Strains Family |
Alpha (B.1.1.7)
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_7927 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Infection Time | 48 h | ||||||||
Interaction Score | FDR ≤ 0.05 | ||||||||
Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) | ||||||||
RNA Region: Not Specified Virus Region (hCoV-19/France/IDF-220-95/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[14] | |||||||
Strains Name |
hCoV-19/France/IDF-220-95/2020
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Direct interaction | ||||||||
Infection Cells | HEK293 Cells (Human embryonic kidney cell) HEK293 Cells (Human embryonic kidney cell) (CVCL_0045 ) | ||||||||
Cell Originated Tissue | Kidney | ||||||||
Infection Time | 48 h | ||||||||
Interaction Score | SAINT score ≥ 0.79 | ||||||||
Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) | ||||||||
RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[15] | |||||||
Strains Name |
hCoV-19/England/02/2020
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Calu-3 cells (Human lung cancer cell) Calu-3 cells (Human lung cancer cell) (CVCL_0609 ) | ||||||||
Cell Originated Tissue | Lung | ||||||||
Infection Time | 24 h | ||||||||
Interaction Score | P-adjust = 0.007 | ||||||||
Method Description | UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) | ||||||||
RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[15] | |||||||
Strains Name |
hCoV-19/England/02/2020
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Calu-3 cells (Human lung cancer cell) Calu-3 cells (Human lung cancer cell) (CVCL_0609 ) | ||||||||
Cell Originated Tissue | Lung | ||||||||
Infection Time | 24 h | ||||||||
Interaction Score | P-adjust = 0.012 | ||||||||
Method Description | UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) |
Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
S113
[16] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
S115
[16] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
S121
[16] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
S138
[16] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
S233
[16] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
S239
[16] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
S241
[16] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Y105
[16] |
![]() |
Protein Sequence Information |
MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS
Click to Show/Hide
|
---|