Details of Host Protein
| Host Protein General Information (ID: PT0517) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Protein Name |
hnRNP A1 messenger RNA (HNRNPA1)
|
Gene Name |
HNRNPA1
|
||||||
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
ROA1_HUMAN
|
||||||
| Subcellular Location |
Nucleus Cytoplasm
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Function in Host |
Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly (A) mRNA from the nucleus to the cytoplasm andmodulation of splice site selection. Plays a role inthe splicing of pyruvate kinase PKM by binding repressively tosequences flanking PKM exon 9, inhibiting exon 9 inclusion andresulting in exon 10 inclusion and production of the PKM M2 isoform. Binds to the IRES and thereby inhibits thetranslation of the apoptosis protease activating factor APAF1. May bind to specific miRNA hairpins.
[1-4]
Click to Show/Hide
|
||||||||
| Related KEGG Pathway | |||||||||
| Spliceosome | hsa03040 |
Pathway Map
|
|||||||
| Amyotrophic lateral sclerosis | hsa05014 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
| Host Protein - Virus RNA Network | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Full List of Virus RNA Interacting with This Protien | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| RNA Region: 3'-UTR (hCoV-SARS/Manitoba/2003 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-SARS/Manitoba/2003
|
||||||||
| Strains Family |
Beta
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome-related coronavirus (HCoV-SARS)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 3'-UTR (hCov-OC43/VR-759 Quebec/2019 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCov-OC43/VR-759 Quebec/2019
|
||||||||
| Strains Family |
Beta
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Human coronavirus OC43 (HCov-OC43)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 3'-UTR (hCov-NL63/Amsterdam/2004 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCov-NL63/Amsterdam/2004
|
||||||||
| Strains Family |
Alpha
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Human Coronavirus NL63 (HCov-NL63)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 3'-UTR (hCov-MERS/Jeddah/2012 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCov-MERS/Jeddah/2012
|
||||||||
| Strains Family |
Beta
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Middle East respiratory syndrome-related coronavirus (HCov-MERS)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 3'-UTR (hCoV-HKU1/Hong Kong/2004 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-HKU1/Hong Kong/2004
|
||||||||
| Strains Family |
Beta
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Human coronavirus HKU1 (HCoV-HKU1)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 3'-UTR (hCov-229E/Würzburg/2000 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCov-229E/Würzburg/2000
|
||||||||
| Strains Family |
Alpha
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Human coronavirus 229E (HCov-229E)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 3'-UTR (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[6] | |||||||
| Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
| RNA Region: 3'-UTR (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: 3'-UTR (hCoV-19/Not Specified Virus Strain ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[7] | |||||||
| Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Huh7 cells (human liver cell line); Calu-3 cells (human lung cancer cell line) Huh7 cells (human liver cell line); Calu-3 cells (human lung cancer cell line) (CVCL_0336;CVCL_0609 ) | ||||||||
| Cell Originated Tissue | Liver; Lung | ||||||||
| Interaction Score | P-value < 0.05 | ||||||||
| Method Description | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | ||||||||
| RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[8] | |||||||
| Strains Name |
hCoV-19/IPBCAMS-YL01/2020
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Infection Time | 30 h | ||||||||
| Interaction Score | Affinity = 0.936 | ||||||||
| Method Description | PrismNet; pull-down western (STAR methods); Mass spectrometry | ||||||||
| RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[9], [10], [11] | |||||||
| Strains Name |
hCoV-19/IPBCAMS-YL01/2020
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | known to be direct binder | ||||||||
| Interaction Binding Type | Single stranded RNA binding | ||||||||
| Infection Cells | Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Infection Time | 30 h | ||||||||
| Interaction Score | MIST = 0.990419848 | ||||||||
| Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) | ||||||||
| RNA Region: 5'-UTR (hCoV-19/IPBCAMS-YL01/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[8] | |||||||
| Strains Name |
hCoV-19/IPBCAMS-YL01/2020
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
5'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Infection Time | 30 h | ||||||||
| Interaction Score | Affinity = 0.932 | ||||||||
| Method Description | PrismNet; pull-down western (STAR methods); Mass spectrometry | ||||||||
| RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[7] | |||||||
| Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
| RNA Binding Region |
ORF10
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Huh7 cells (human liver cell line) Huh7 cells (human liver cell line) (CVCL_0336 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Interaction Score | P-value < 0.05 | ||||||||
| Method Description | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | ||||||||
| RNA Region: ORF1ab (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[6] | |||||||
| Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
ORF1ab
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
| RNA Region: ORF8 (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[6] | |||||||
| Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
ORF8
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
| RNA Region: M region (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[6] | |||||||
| Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
M region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
| RNA Region: N region (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[6] | |||||||
| Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
N region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
| RNA Region: 5'-UTR of ORF6 (hCoV-19/Not Specified Virus Strain ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[7] | |||||||
| Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
| RNA Binding Region |
5'-UTR of ORF6
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Huh7 cells (human liver cell line); Calu-3 cells (human lung cancer cell line) Huh7 cells (human liver cell line); Calu-3 cells (human lung cancer cell line) (CVCL_0336;CVCL_0609 ) | ||||||||
| Cell Originated Tissue | Liver; Lung | ||||||||
| Interaction Score | P-value < 0.05 | ||||||||
| Method Description | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | ||||||||
| RNA Region: S region (hCoV-19/Wuhan/WHUH020/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-19/Wuhan/WHUH020/2020
|
||||||||
| Strains Family |
Epsilon (B.1.427; B.1.429)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[6] | |||||||
| Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Method Description | ATtRACT Database; Position Weight Matrices (PWMs); TFBSTools R package | ||||||||
| RNA Region: S region (hCoV-19/USA/CA-CZB-14678/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-19/USA/CA-CZB-14678/2020
|
||||||||
| Strains Family |
Epsilon (B.1.427; B.1.429)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/NewZealand/20CV0676/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-19/NewZealand/20CV0676/2020
|
||||||||
| Strains Family |
Epsilon (B.1.427; B.1.429)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Namibia/N17380/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-19/Namibia/N17380/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Namibia/CERI-KRISP-K022530/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-19/Namibia/CERI-KRISP-K022530/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Kyrgyzstan/ChVir26576_10/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-19/Kyrgyzstan/ChVir26576_10/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Kazakhstan/1872/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-19/Kazakhstan/1872/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Iraq/Thi-Qar-1/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-19/Iraq/Thi-Qar-1/2021
|
||||||||
| Strains Family |
Delta (B.1.617.2 and AY lineages)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: S region (hCoV-19/Guam/GU-CDC-2-3906081-/2021 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[5] | |||||||
| Strains Name |
hCoV-19/Guam/GU-CDC-2-3906081-/2021
|
||||||||
| Strains Family |
Epsilon (B.1.427; B.1.429)
|
||||||||
| RNA Binding Region |
S region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Potential binding protein | ||||||||
| Infection Cells | HepG2 cells (hepatocellular carcinoma cell line) HepG2 cells (hepatocellular carcinoma cell line) (CVCL_0027 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Method Description | ENCODE project database; Pysster model; DeepRiPe (Section 3.6; 3.7; 3.8; 3.9); ClustalO (72) algorithm | ||||||||
| RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[12] | |||||||
| Strains Name |
hCoV-19/USA/WA1/2020
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_7927 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Infection Time | 48 h | ||||||||
| Interaction Score | FDR ≤ 0.05 | ||||||||
| Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) | ||||||||
| RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[13] | |||||||
| Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Huh7 cells (liver carcinoma cell) Huh7 cells (liver carcinoma cell) (CVCL_0336 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Infection Time | 24h | ||||||||
| Interaction Score | log2FC = 2.06787E+14 | ||||||||
| Method Description | RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot | ||||||||
| RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[14] | |||||||
| Strains Name |
hCoV-19/England/02/2020
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Calu-3 cells (Human lung cancer cell) Calu-3 cells (Human lung cancer cell) (CVCL_0609 ) | ||||||||
| Cell Originated Tissue | Lung | ||||||||
| Infection Time | 24 h | ||||||||
| Interaction Score | P-adjust = 0.030 | ||||||||
| Method Description | UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) | ||||||||
| Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
S199
[15] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
S337
[15] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
S338
[15] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
S363
[15] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
S364
[15] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
S4
[15] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
S6
[16] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
S6
[15] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
S95
[15] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Potential Drug(s) that Targets This Protein | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Drug Name | DrunkBank ID | Pubchem ID | TTD ID | REF | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CAMPTOTHECIN | DB04690 | 24360 | D09YDM | [8] | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PACLITAXEL | DB01229 | 36314 | D0C4RB | [8] | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Toremifene | DB00539 | 3005573 | D04VFJ | [17] | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Sequence Information |
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF
Click to Show/Hide
|
|---|













